PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_33196_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 62aa    MW: 7146.35 Da    PI: 10.9212
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_33196_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.21.9e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr g+lKKA+E+SvLCdaevaviifs++gkl+eys+
  Neem_33196_f_2  9 KRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVAVIIFSHKGKLFEYST 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.071161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-30261IPR002100Transcription factor, MADS-box
CDDcd002652.13E-36261No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-32323IPR002100Transcription factor, MADS-box
PfamPF003194.6E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRGGLLK KAHEISVLCD AEVAVIIFSH KGKLFEYSTD  60
SW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-20160161Myocyte-specific enhancer factor 2B
1tqe_Q1e-20160161Myocyte-specific enhancer factor 2B
1tqe_R1e-20160161Myocyte-specific enhancer factor 2B
1tqe_S1e-20160161Myocyte-specific enhancer factor 2B
3mu6_A1e-20260160Myocyte-specific enhancer factor 2A
3mu6_B1e-20260160Myocyte-specific enhancer factor 2A
3mu6_C1e-20260160Myocyte-specific enhancer factor 2A
3mu6_D1e-20260160Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3389752e-58AY338975.1 Citrus sinensis APETALA1 (AP1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156376.12e-36hypothetical protein PHAVU_003G2810000g, partial
RefseqXP_014624024.12e-35PREDICTED: truncated transcription factor CAULIFLOWER A isoform X2
SwissprotQ388761e-35AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBLA0A151TRY32e-38A0A151TRY3_CAJCA; Agamous-like MADS-box protein AGL8 isogeny
STRINGBra004361.1-P1e-34(Brassica rapa)
STRINGGLYMA16G13070.13e-34(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.17e-37AGAMOUS-like 8